DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and SDR3

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:255 Identity:86/255 - (33%)
Similarity:130/255 - (50%) Gaps:10/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            ||:.:|||.:|||||.....|..:||.:.:.....|..:.||.   .|.:.:.:....|:..|.:
plant     8 GKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQEELGQNVAV---SVGKDKASFYRCDVTNEKE 69

  Fly    70 TQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK-- 131
            .:.....|:::|||||||.:|||::| .|:....:|||:||.|..|:|........|...:|:  
plant    70 VENAVKFTVEKYGKLDVLFSNAGVMEQPGSFLDLNLEQFDRTMAVNVRGAAAFIKHAARAMVEKG 134

  Fly   132 TKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGG 196
            |:|:||..:||......||..||..||..:....:.....|...|:|||.|.|....|.:::|  
plant   135 TRGSIVCTTSVASEIGGPGPHAYTASKHALLGLVKSACGGLGKYGIRVNGVAPYAVATAINSR-- 197

  Fly   197 MDAETYKKFLEHSKTTHAL-GRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCP 255
             |.||.:...|:|..|..| |.....:.||.|..|||||::::.:|.:|.||||...:.|
plant   198 -DEETVRMVEEYSAATGILKGVVLKARHVAEAALFLASDDSAYVSGQNLAVDGGYSVVKP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 84/248 (34%)
NADB_Rossmann 3..253 CDD:304358 85/251 (34%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 85/251 (34%)
NADB_Rossmann 5..252 CDD:304358 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.