DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G47120

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001325398.1 Gene:AT2G47120 / 819325 AraportID:AT2G47120 Length:259 Species:Arabidopsis thaliana


Alignment Length:263 Identity:81/263 - (30%)
Similarity:129/263 - (49%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLAL------NGRNVENLKKVAAECSKVSQSQPALVVGD 63
            ||:|:|||.:|||||..|..|..:||.:.:      .|:||..|         :.:.:.:....|
plant     9 GKIVIITGGASGIGADAARLFTDHGAKVVIVDVQEELGQNVAVL---------IGKDKASFYRCD 64

  Fly    64 IAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIET---TSLEQYDRVMNTNLRAIYHLTMLA 125
            :..|.:.:.....|::::||||||.:|||::|  .:|:   ..||::||:|..|:|........|
plant    65 VTNETEVEDAVKFTVEKHGKLDVLFSNAGVLE--PLESFLDFDLERFDRIMAVNVRGAAAFIKHA 127

  Fly   126 TPELVK--TKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            ...:|:  |:|:||..:||:. ....|...|..||.|:....|....:|...|:|||.|.|....
plant   128 ARAMVEKGTRGSIVCTTSVSA-EIGGGHHGYTASKHGLVGLIRSACGDLGKYGIRVNGVAPYAVA 191

  Fly   189 TNLHARGGMDAETYKKFLEHSKTTHAL-GRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHA 252
            |.:.:.   |..|.|:..::......| |.......||....|||||::::.:|.:|.||||...
plant   192 TPMTSH---DEVTGKQLEDYFDAKGILKGMVLKASHVAQVALFLASDDSAYISGQNLAVDGGYTV 253

  Fly   253 MCP 255
            :.|
plant   254 VKP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 79/256 (31%)
NADB_Rossmann 3..253 CDD:304358 80/259 (31%)
AT2G47120NP_001325398.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.