DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G29360

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_180497.1 Gene:AT2G29360 / 817485 AraportID:AT2G29360 Length:271 Species:Arabidopsis thaliana


Alignment Length:257 Identity:88/257 - (34%)
Similarity:136/257 - (52%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGA----CLALNGRNVENLKKVAAECSKVSQSQPALVVG 62
            :..|...|:||.|.|||.|...:.|..||    |.....:..|:|:|..|:..:|:.|     |.
plant    15 SLVGMTALVTGGSKGIGEAVVEELATLGARIHTCARDETQLQESLRKWQAKGFQVTTS-----VC 74

  Fly    63 DIAKEADTQRIWSETLQQY--GKLDVLVNNAG-IIETGTIETTSLEQYDRVMNTNLRAIYHLTML 124
            |::.....::: .||:...  |||::||||.| .|...|::.|: |.:...|.|||.:.:||:.|
plant    75 DVSSRDKREKL-METVSTIFEGKLNILVNNVGTCIVKPTLQHTA-EDFSFTMATNLESAFHLSQL 137

  Fly   125 ATPELVKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVT 187
            |.| |:|.  .|:||.:|||:|:....|...|.:||..::|..|.:|.|.|:..:|.|.|.|...
plant   138 AHP-LLKASGSGSIVLISSVSGVVHVNGASIYGVSKGAMNQLGRNLACEWASDNIRTNSVCPWFI 201

  Fly   188 VTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .|.| ....:..|.::|.:|   :...:||.|:|.||::.:|||....||:.||.::.||||
plant   202 ETPL-VTESLSNEEFRKEVE---SRPPMGRVGEVNEVSSLVAFLCLPAASYITGQTICVDGG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 88/257 (34%)
NADB_Rossmann 3..253 CDD:304358 88/256 (34%)
AT2G29360NP_180497.1 NADB_Rossmann 13..263 CDD:419666 88/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.