DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G29340

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_565680.2 Gene:AT2G29340 / 817483 AraportID:AT2G29340 Length:307 Species:Arabidopsis thaliana


Alignment Length:252 Identity:83/252 - (32%)
Similarity:135/252 - (53%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSK----VSQSQPALVVGDIA 65
            |...|:||.:||||.|...:.|.:||.:.:...:...|.:..:|..|    ||.|     |.|:|
plant     9 GMTALVTGGASGIGYAIVEELAGFGARIHVCDISEAKLNQSLSEWEKKGFQVSGS-----VCDVA 68

  Fly    66 KEADTQRIWSETLQQY-GKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            ...:.:.:......|: |||::||:|.|:|.:......:.:.:...:::|:.|.||.:.|:.| |
plant    69 SRPEREELMQTVSSQFDGKLNILVSNVGVIRSKPTTEYTEDDFAFHISSNVEAAYHFSQLSHP-L 132

  Fly   130 VKTK--GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLH 192
            :|..  |:|:.|||:.|:.||.....|.::|..:.|..:.:|.|.|..|:|.|.|.|.|..|.| 
plant   133 LKASGYGSIIFVSSIAGVISFDAGSIYGLTKGALIQLAKNLACEWAKDGIRANAVAPNVINTPL- 196

  Fly   193 ARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            ::..::..::||.| .|:|  .|||.|:..|||:.:|||....||:.||.::.||||
plant   197 SQSYLEDVSFKKAL-LSRT--PLGRVGEPNEVASLVAFLCLPAASYITGQTICVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 83/252 (33%)
NADB_Rossmann 3..253 CDD:304358 83/252 (33%)
AT2G29340NP_565680.2 PRK09242 1..256 CDD:181721 83/252 (33%)
NADB_Rossmann 4..254 CDD:304358 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.