DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G29290

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001118408.1 Gene:AT2G29290 / 817478 AraportID:AT2G29290 Length:262 Species:Arabidopsis thaliana


Alignment Length:249 Identity:71/249 - (28%)
Similarity:124/249 - (49%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |...|:||.:.|||.|...:.:..||.:....|:...|::...|..: ...|....:.|::....
plant     9 GMNALVTGGTKGIGEAVVEELSILGARVHTCARDETQLQERLREWQE-KGFQVTTSICDVSLREQ 72

  Fly    70 TQRIWSETLQQ--YGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            .::: .||:..  .|||::||||.|.:........:.|::..:|.|||.:.:|::.||.| |:|.
plant    73 REKL-METVSSLFQGKLNILVNNVGTLMLKPTTEYTAEEFSFLMATNLDSAFHISQLAHP-LLKA 135

  Fly   133 --KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
              .|:||.:||:.|:........|..:|..::|..|.:|.|.|:..:|.|.:.|.:..|.|.:  
plant   136 SGSGSIVLMSSIAGVVHVGVGSIYGATKGAMNQLARNLACEWASDNIRTNAICPWLITTPLIS-- 198

  Fly   196 GMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
              |..:.::..:.::....:||.|:..||:..:|||....||:.||..:.||||
plant   199 --DLLSVEEMKKEAEERTPMGRVGEANEVSPLVAFLCLPAASYITGQVICVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 71/249 (29%)
NADB_Rossmann 3..253 CDD:304358 71/249 (29%)
AT2G29290NP_001118408.1 NADB_Rossmann 4..254 CDD:419666 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.