DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G29260

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_180489.1 Gene:AT2G29260 / 817475 AraportID:AT2G29260 Length:322 Species:Arabidopsis thaliana


Alignment Length:249 Identity:82/249 - (32%)
Similarity:135/249 - (54%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |...|:||.:.|||.|...:.|..||.:....||...|:...::.:: |..:.|..|.|::..:.
plant    70 GMSALVTGGTRGIGRAIVEELAGLGAEVHTCARNEYELENCLSDWNR-SGFRVAGSVCDVSDRSQ 133

  Fly    70 TQRIWSETLQQY--GKLDVLVNNAGI-IETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            .:.: .||:...  |||.:||||.|. |....:|.|:.| :..:|:||..:::||..||.|.|.:
plant   134 REAL-METVSSVFEGKLHILVNNVGTNIRKPMVEFTAGE-FSTLMSTNFESVFHLCQLAYPLLRE 196

  Fly   132 TK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
            :| |::|.:|||:|..|...:...:.:|..::|.||.:|.|.|...:|:|.|.|....|::..: 
plant   197 SKAGSVVFISSVSGFVSLKNMSVQSSTKGAINQLTRSLACEWAKDNIRINAVAPWYIKTSMVEQ- 260

  Fly   196 GMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
               ..:.|::||...:...|||.|:.:||::|:|||....:|:.||..|.||||
plant   261 ---VLSNKEYLEEVYSVTPLGRLGEPREVSSAVAFLCLPASSYITGQILCVDGG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 82/249 (33%)
NADB_Rossmann 3..253 CDD:304358 82/249 (33%)
AT2G29260NP_180489.1 NADB_Rossmann 65..315 CDD:419666 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.