DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and AT2G29150

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_180479.1 Gene:AT2G29150 / 817464 AraportID:AT2G29150 Length:268 Species:Arabidopsis thaliana


Alignment Length:256 Identity:91/256 - (35%)
Similarity:136/256 - (53%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGA----CLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            |...|:||.|.|:|.|...:.|..||    |.....:..|.|::..|:..:|:.|     |.|::
plant    18 GMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWQAKGFEVTTS-----VCDVS 77

  Fly    66 KEADTQRIWSETLQQ--YGKLDVLVNNAGIIETGTIETT---SLEQYDRVMNTNLRAIYHLTMLA 125
            .....::: .||:..  .|||::||||||   ||.|:.:   :.|.|..:|.|||.:.:||:.:|
plant    78 SREQREKL-METVSSVFQGKLNILVNNAG---TGIIKPSTEYTAEDYSFLMATNLESAFHLSQIA 138

  Fly   126 TPELVKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            .| |:|.  .|:||.:|||.|: ...|...|..||..::|..|.:|.|.|:..:|||.|.|.|..
plant   139 HP-LLKASGSGSIVFMSSVAGL-VHTGASIYGASKGAMNQLGRSLACEWASDNIRVNSVCPWVIT 201

  Fly   189 TNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            |.|.:....| |..:|.:| .||  .:||.|:..||::.:|||....||:.||.::.||||
plant   202 TPLTSFIFSD-EKLRKAVE-DKT--PMGRVGEANEVSSLVAFLCFPAASYITGQTICVDGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 91/256 (36%)
NADB_Rossmann 3..253 CDD:304358 91/256 (36%)
AT2G29150NP_180479.1 PRK09242 11..264 CDD:181721 91/256 (36%)
NADB_Rossmann 13..262 CDD:304358 91/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 1 0.900 - - OOG6_101836
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.