DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and HSD17B8

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:253 Identity:78/253 - (30%)
Similarity:122/253 - (48%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLAL----NGRNVENLKKVAAECSKVS--QSQPALVVGDIA 65
            :.|:|||.||||.|.:::.|..||.:|.    .....|.::.:....||..  :...|....|::
Human    13 LALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVS 77

  Fly    66 KEADTQRIWSETLQQYGKL--DVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPE 128
             ||...|...|.:|.....  .|:|:.|||.:...:...|.:.:|:|:..||:..:.:|..|...
Human    78 -EARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQA 141

  Fly   129 LVKT--KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            ||..  :|:|:|:||:.|.....|...|..||.||...|:..|.||...|:|.|.|.||...|  
Human   142 LVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIAT-- 204

  Fly   192 HARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
                .|..:..:|.::.......:|..||.::||..:|||||:::.:.||.|:.|.||
Human   205 ----PMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 78/253 (31%)
NADB_Rossmann 3..253 CDD:304358 78/253 (31%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.