DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and HSD17B8

DIOPT Version :10

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_055049.1 Gene:HSD17B8 / 7923 HGNCID:3554 Length:261 Species:Homo sapiens


Alignment Length:37 Identity:11/37 - (29%)
Similarity:15/37 - (40%) Gaps:15/37 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SQLKPLYKE---------------DNITISELSTALG 79
            :||.|.:||               :.:|||.|..|.|
Human   325 AQLLPHWKETHRFIEDARLLGLKGNGLTISHLHRAQG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 Rossmann-fold NAD(P)(+)-binding proteins 3..253 CDD:473865 11/37 (30%)
HSD17B8NP_055049.1 BKR_SDR_c 13..260 CDD:187594
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.