DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:158868

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001074098.1 Gene:zgc:158868 / 791147 ZFINID:ZDB-GENE-070112-892 Length:258 Species:Danio rerio


Alignment Length:231 Identity:58/231 - (25%)
Similarity:90/231 - (38%) Gaps:56/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLITGASSGIGAATAIKFAK--------YGACLALNGRNVENLKKVAAECSKVSQSQPALVV--- 61
            ||:||::.|||.....:...        :..|....|...:.|:.:|      .:.|..:.|   
Zfish     9 VLVTGSNRGIGLELVHQLVDLPKSPGHIFAGCRDPGGPKAQELRDLA------QKHQGVITVVQL 67

  Fly    62 ----GDIAKEADTQRIWSETLQQYGKLDVLVNNAGI-IETGTIETTSLEQYDRVMNTNLRAIYHL 121
                .|..|||  ..:....|...| |::::||||: |....:||...|..|. ..||:.....:
Zfish    68 DTDSPDSIKEA--SNLVESKLNGKG-LNLIINNAGVNIPGSLVETGKKEMVDS-YTTNVVGPMLI 128

  Fly   122 TMLATPELVK------------TKGNIVNVSSV---------NGIRS--FPGVLAYNISKMGVDQ 163
            .....|.|.|            ::..|||||::         |..||  :|    |.|.|..::.
Zfish   129 AKNFHPLLCKAAAQFPQSSMSCSRPAIVNVSTLLSSITRCPENFYRSPMYP----YRICKAALNM 189

  Fly   164 FTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDA 199
            .|||:|.:....|:.|..::||...|.:   ||..|
Zfish   190 LTRCLAEDFRKDGILVASLHPGWVRTEM---GGPQA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 58/231 (25%)
NADB_Rossmann 3..253 CDD:304358 58/231 (25%)
zgc:158868NP_001074098.1 carb_red_sniffer_like_SDR_c 9..258 CDD:187586 58/231 (25%)
adh_short 9..220 CDD:278532 56/227 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.