DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and MGC147226

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:253 Identity:82/253 - (32%)
Similarity:132/253 - (52%) Gaps:9/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            |...|:|..:||...|||.|.|....:.||.:|:....:|..:.||.|. :|...:...:..||:
 Frog   272 MRLDGRVAYVTGGGQGIGRAFAHALGEAGAKVAVVDLMLEKAEAVAFEL-QVKGIKSVAIAADIS 335

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLA-TPEL 129
            ||.|.:||....:..:|::|:..|||||......|.|:||::|:..:.|||.::.....| ...|
 Frog   336 KEEDVKRIVDTIVTNWGRIDIACNNAGINMNSASEDTTLEEWDKTFSVNLRGLFMCCQAAGRVML 400

  Fly   130 VKTKGNIVNVSSVNG-IRSFP-GVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLH 192
            .:..|.|:|.:|:.. |...| ..||||.||.||.:.|:.:..|...:||||||::||:..|.| 
 Frog   401 SQGYGKIINTASMASLIVPHPQKQLAYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDTPL- 464

  Fly   193 ARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGR 250
                :.::..|..::........||...|.::.|.:.||||:.:.:.||.:|.::||:
 Frog   465 ----IHSDALKPLVQRWLNDIPAGRLAQVTDLQAGVVFLASEASDYMTGHNLVIEGGQ 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 81/251 (32%)
NADB_Rossmann 3..253 CDD:304358 81/251 (32%)
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410
NADB_Rossmann 269..518 CDD:389744 81/251 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.