Sequence 1: | NP_730974.1 | Gene: | CG31548 / 318794 | FlyBaseID: | FBgn0051548 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_077217.2 | Gene: | Hsdl2 / 72479 | MGIID: | 1919729 | Length: | 490 | Species: | Mus musculus |
Alignment Length: | 212 | Identity: | 66/212 - (31%) |
---|---|---|---|
Similarity: | 101/212 - (47%) | Gaps: | 20/212 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKV------AAECSKVSQSQPALVVG 62
Fly 63 DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126
Fly 127 PELVKTK-GNIVNVSSVNGIRS--FPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
Fly 189 TNLHAR-----GGMDAE 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31548 | NP_730974.1 | fabG | 1..250 | CDD:235975 | 66/212 (31%) |
NADB_Rossmann | 3..253 | CDD:304358 | 66/212 (31%) | ||
Hsdl2 | NP_077217.2 | HSDL2_SDR_c | 8..248 | CDD:187663 | 66/212 (31%) |
adh_short | 12..197 | CDD:278532 | 58/186 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 282..370 | ||||
SCP2 | 390..483 | CDD:280250 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |