DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Hsdl2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_077217.2 Gene:Hsdl2 / 72479 MGIID:1919729 Length:490 Species:Mus musculus


Alignment Length:212 Identity:66/212 - (31%)
Similarity:101/212 - (47%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKV------AAECSKVSQSQPALVVG 62
            ||..|.|||||.|||.|.|:|.||.||.:.:..:..:...|:      |||..:.:.......|.
Mouse     9 AGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQKHPKLLGTIYTAAEEIEAAGGTALPCVV 73

  Fly    63 DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126
            |:..|........:.::::|.:|:|||||..|. |.|::|.: ::.|.:||.|.|..|..:....
Mouse    74 DVRDEQQINSAVEKAVEKFGGIDILVNNASAISLTNTLDTPT-KRVDLMMNVNTRGTYLTSKACI 137

  Fly   127 PELVKTK-GNIVNVSSVNGIRS--FPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            |.|.|:| |:|:|:|....:..  |....||.|:|.|:......:|.|...: :.||.:.|.   
Mouse   138 PFLKKSKVGHILNLSPPLNLNPLWFKQHCAYTIAKYGMSMCVLGMAEEFRGE-IAVNALWPR--- 198

  Fly   189 TNLHAR-----GGMDAE 200
            |.:|..     ||...|
Mouse   199 TAIHTAAMDMLGGSGVE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 66/212 (31%)
NADB_Rossmann 3..253 CDD:304358 66/212 (31%)
Hsdl2NP_077217.2 HSDL2_SDR_c 8..248 CDD:187663 66/212 (31%)
adh_short 12..197 CDD:278532 58/186 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..370
SCP2 390..483 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.