DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_001078405.4 Gene:Dhrs2 / 691464 RGDID:1583909 Length:289 Species:Rattus norvegicus


Alignment Length:250 Identity:77/250 - (30%)
Similarity:126/250 - (50%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---DIA 65
            ||||.::||::.|||.|.|.:.|:.||.:.::.|..||:|    |...:.:.:...|.|   .:.
  Rat    43 AGKVAVVTGSTRGIGFAIARRMARDGAHVVISSRKQENVK----EAVDILKEEGLSVTGTVCHVG 103

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            |..|.|.:.:..|:..|.:|.||..||:.. .|:....|.:.:|::::.|:::...|.....|.:
  Rat   104 KAEDRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLAASEQIWDKILDVNVKSPALLLSQVLPHM 168

  Fly   130 VKTKGN-IVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA 193
            ....|. :|.|||.......|.:..||.||..:....:.:|:|||.||:||||:.||:..|:...
  Rat   169 ENRGGGCVVLVSSAVAYLPVPRLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLAPGIIKTDFSL 233

  Fly   194 RGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDG 248
            |    .||....|...|....:.|.|:.:|.|..::||.|.:.|:.||.::.|.|
  Rat   234 R----EETMPNMLPELKKVFGVQRLGEPEECAGLVSFLCSSDGSYITGENIVVGG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 76/249 (31%)
NADB_Rossmann 3..253 CDD:304358 76/249 (31%)
Dhrs2XP_001078405.4 NADB_Rossmann 42..287 CDD:304358 76/249 (31%)
fabG 42..284 CDD:235975 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.