DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and BDH2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 / 56898 HGNCID:32389 Length:259 Species:Homo sapiens


Alignment Length:271 Identity:84/271 - (30%)
Similarity:132/271 - (48%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALV--VGDIAKE 67
            |||:::|.|:.|||.|.|:.||:.||.:.....|...|:::        :..|.:.  |.|:.|:
Human     6 GKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQEL--------EKYPGIQTRVLDVTKK 62

  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            ....:..:|.    .:||||.|.||.:..||:.....:.:|..||.|:|::|.:.....|:::..
Human    63 KQIDQFANEV----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQ 123

  Fly   133 K-GNIVNVSSVNGIRSFPGVLA------------------YNISKMGVDQFTRCVALELAAKGVR 178
            | |||:|:|||   .|...|:|                  |:.:|..|...|:.||.:...:|:|
Human   124 KSGNIINMSSV---ASSVKVMATDDEKLRLPMLRVVNRCVYSTTKAAVIGLTKSVAADFIQQGIR 185

  Fly   179 VNCVNPGVTVT-----NLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASF 238
            .|||.||...|     .:.|||..: |....||:..||    ||....:|:|....:|||||:::
Human   186 CNCVCPGTVDTPSLQERIQARGNPE-EARNDFLKRQKT----GRFATAEEIAMLCVYLASDESAY 245

  Fly   239 STGVSLPVDGG 249
            .||..:.:|||
Human   246 VTGNPVIIDGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 84/271 (31%)
NADB_Rossmann 3..253 CDD:304358 84/271 (31%)
BDH2XP_006714337.1 DHRS6_like_SDR_c 5..259 CDD:187626 84/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.