DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:163083

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001077028.1 Gene:zgc:163083 / 566848 ZFINID:ZDB-GENE-070424-53 Length:257 Species:Danio rerio


Alignment Length:254 Identity:63/254 - (24%)
Similarity:105/254 - (41%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLITGASSGIGAATAIKFAK-------YGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            :|||||:.|:|.....:.::       :..|...:|.....|:::|       :..|.|:. .|.
Zfish     9 ILITGANRGLGLEMVKQLSENSCPKHIFATCRDPDGPKSAALRELA-------KKHPNLIT-IIR 65

  Fly    66 KEADTQRIWSETLQQYGK------LDVLVNNAGIIETGTIETTSLEQYDRVMNTNL--------- 115
            .:||......|:.::.|.      |::|||||.|:..|||:|:|:|......|||:         
Zfish    66 LDADDPCSIKESAKKVGSLVGANGLNLLVNNAAIVANGTIQTSSVEDLKNTFNTNVIGPLLIIRE 130

  Fly   116 -RAIYHLTMLA--TPELVKTKGNIVNVSSVNG-------IRSFPGVLAYNISKMGVDQFTRCVAL 170
             |....:...|  ||.:...|..|:|:|:|..       |.|....|.|.:||.|.:..|...|.
Zfish   131 YRPYLQIAAKASGTPGMSSKKAAIINISTVAASMTRMPPIYSHFQTLPYAVSKAGFNMLTVLAAE 195

  Fly   171 ELAAKGVRVNCVNPGVTVTNLHAR-----------------GGMDAETYKKFLEHSKTT 212
            |:....:....::||...|:|..|                 ||:..:.:..||:::..|
Zfish   196 EVKTDEILCMALHPGWVKTDLGGRDATLEPNESVEGMLKVIGGLTEKQHGGFLDYTGAT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 63/254 (25%)
NADB_Rossmann 3..253 CDD:304358 63/254 (25%)
zgc:163083NP_001077028.1 carb_red_sniffer_like_SDR_c 9..257 CDD:187586 63/254 (25%)
adh_short 9..216 CDD:278532 56/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.