DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and dhrs7ca

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001013557.2 Gene:dhrs7ca / 558764 ZFINID:ZDB-GENE-050320-114 Length:319 Species:Danio rerio


Alignment Length:238 Identity:68/238 - (28%)
Similarity:102/238 - (42%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPA------LVVGDI 64
            ||||||.:.|.:|...|..|...||.|.|.|.|.|.|:.:|.:.:  |||.|.      ||..|.
Zfish    46 KVVLITDSLSTVGNECAKLFHAGGARLILCGSNWEKLEALAEQLT--SQSDPTLTFPPKLVELDF 108

  Fly    65 AKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            :.......:.||.|:.:..|||||.|:.:.....:.:.||:....:|:.|......|.....|.|
Zfish   109 SGMESVPEVISEILECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLPSL 173

  Fly   130 V-KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVN-------PGV 186
            : :..|:|:.|:|:.|..:.|....|..||..|..|..|:..|:...|:.|:.:|       ..:
Zfish   174 ISRRSGHILLVNSIQGKLAMPFRTTYAASKHAVQAFFECLRAEVQEYGITVSTINHTFIKTSSSI 238

  Fly   187 TVTNLHARGGMDAETYKKFLEHSKTTHALGRPG-DVKEVAAAI 228
            :...:.||.             .||.|....|| ..|:||..:
Zfish   239 SKDEITARS-------------MKTDHRQTPPGVSPKDVATEL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 68/238 (29%)
NADB_Rossmann 3..253 CDD:304358 68/238 (29%)
dhrs7caNP_001013557.2 11beta-HSD1_like_SDR_c 43..303 CDD:187593 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.