DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and PECR

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR / 55825 HGNCID:18281 Length:303 Species:Homo sapiens


Alignment Length:256 Identity:81/256 - (31%)
Similarity:126/256 - (49%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAEC-SKVSQSQPALVVG---DIA 65
            |:|.::||.::|||.|...:..:.|:.:.:..|.:|.||..|.|. :.:..::.|.|:.   :|.
Human    18 GQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIR 82

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            .|.:...:...||..:||::.||||.|.......|..|.:.:..|:.|||...:::........:
Human    83 NEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWM 147

  Fly   131 KTK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGV-----TVT 189
            |.. |:|||: .|.....||..:....::.||...|:.:|||.|..|:|:|||.|||     .|.
Human   148 KEHGGSIVNI-IVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVE 211

  Fly   190 NLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGR 250
            |..:.|       :.|.|.|.......|.|..:||::.:.||.|..|||.||.|:.|||||
Human   212 NYGSWG-------QSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 79/254 (31%)
NADB_Rossmann 3..253 CDD:304358 81/256 (32%)
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 81/256 (32%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.