DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and si:dkey-12e7.4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001137514.1 Gene:si:dkey-12e7.4 / 558132 ZFINID:ZDB-GENE-050419-83 Length:256 Species:Danio rerio


Alignment Length:268 Identity:69/268 - (25%)
Similarity:113/268 - (42%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLITGASSGIGAATAIKFAKYG------ACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAK 66
            ::|||||.|:|..........|      ...|.|....:.|:::|.|...:.     ::..|:..
Zfish    11 LMITGASRGLGLQIVESLVTGGFSPGKIIATARNPNGAKELQRLAEEYQNIH-----IIKLDVIS 70

  Fly    67 EADTQRIWSET---LQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPE 128
            :...:|..:|.   :|:.| |:.|:|||||.....:||.:.:|.....:||..|...:|....|.
Zfish    71 QESIERAAAEVEELVQEEG-LNCLINNAGINVVANLETVTADQMLENFHTNSVAPLMITKAMLPL 134

  Fly   129 LVK--TKGN--------IVNVSSVNG-IRSFPGVLA-------YNISKMGVDQFTRCVALELAAK 175
            |.:  .||.        ::||:|:.| :..:.|..|       |..||..::..|||:|::|.|.
Zfish   135 LKRAAAKGTGMGIHRAAVINVTSLLGSVELYWGDRADTFKWYPYRTSKSALNMVTRCLAVDLEAD 199

  Fly   176 GVRVNCVNPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLA-SDEASF- 238
            |:....::||...|::   ||.:|              .|.....:..|.:.|..|. .|..|| 
Zfish   200 GILCMALHPGWVRTDM---GGPEA--------------PLSPEESISSVLSVIGGLTEKDHGSFL 247

  Fly   239 -STGVSLP 245
             .||.:||
Zfish   248 HYTGETLP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 69/268 (26%)
NADB_Rossmann 3..253 CDD:304358 69/268 (26%)
si:dkey-12e7.4NP_001137514.1 carb_red_sniffer_like_SDR_c 12..256 CDD:187586 69/267 (26%)
adh_short 13..218 CDD:278532 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.