DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and dhrs7cb

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb / 553684 ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio


Alignment Length:259 Identity:68/259 - (26%)
Similarity:106/259 - (40%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKV-AAECSKVSQSQ---PALVVGDIAK 66
            |||:||.|.||:|:..|..|...||.|.|.|.:.:.|:.: .:.||....||   |.||:.|.:.
Zfish    38 KVVVITDAVSGMGSECARLFHAGGARLVLCGPSWDKLESLYDSLCSGSDPSQTFTPKLVLLDFSD 102

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV- 130
            ..:...:.||..:.||.:|||:.|:.:.....::..|||....:|:.|......|.....|.:: 
Zfish   103 MENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMIT 167

  Fly   131 KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNC-----VNPG----- 185
            :..|..|.|:|:.|..:.|....|..||..|..|..|:..|:...|:.|:.     :|.|     
Zfish   168 RRTGQFVLVNSIQGKLALPFRTCYAASKHAVQAFFDCLRAEVEEFGISVSTISHTFINAGAENAT 232

  Fly   186 ------VTVT------------------NLHARG----------GMDAETYKKFLEHSKTTHAL 215
                  :|.|                  |.|..|          .::.::.:.||.|...|.||
Zfish   233 PTEATPITATPTKATPTNPIWAYVCSKLNTHGVGPQILAREIVRSVNRQSREVFLAHPVPTVAL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 68/259 (26%)
NADB_Rossmann 3..253 CDD:304358 68/259 (26%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 68/259 (26%)
adh_short 38..219 CDD:278532 55/180 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.