DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:110339

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001017792.1 Gene:zgc:110339 / 550490 ZFINID:ZDB-GENE-050417-323 Length:255 Species:Danio rerio


Alignment Length:283 Identity:73/283 - (25%)
Similarity:116/283 - (40%) Gaps:71/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFA--GKVVLITGASSGIG-------AATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQP 57
            |||  |. |||||||.|:|       .||..:..|..|.:    ||    ...|.|..|::::.|
Zfish     4 NFAKCGS-VLITGASRGLGLQMVKQLLATPERPQKIIATV----RN----PAAAEELQKLAKAHP 59

  Fly    58 --ALVVGDIAKE----ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLR 116
              .:|..||:.|    |.:|.:  |.:.....|:.|:|||.|..:..:::.:.:...:...:|..
Zfish    60 DVHIVTLDISNETSVNAASQAV--EAIVGANGLNCLINNAAIGMSSDLDSVTRDVMMKTYESNTV 122

  Fly   117 AIYHLTMLATPELVKT----------KGNIVNVSSVNG-----------IRSFPGVLAYNISKMG 160
            :...:|....|.|.:.          :..:|||||:.|           .:|:    ||..||..
Zfish   123 SPLFVTKALLPLLRRAAAEGSGMSIQRAAVVNVSSLLGSVQLNWGEGASFKSY----AYRASKSA 183

  Fly   161 VDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVA 225
            ::..|||:|.:|.|.|:....::||...|::   ||..|              .|.....:..|.
Zfish   184 LNMVTRCLAADLEADGILCVALHPGWVRTDM---GGPMA--------------PLSPEESISSVL 231

  Fly   226 AAIAFLASDEAS---FSTGVSLP 245
            :.||.|..:...   ..||.:||
Zfish   232 SVIAGLKEEHHGGYVDYTGKNLP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 73/283 (26%)
NADB_Rossmann 3..253 CDD:304358 72/282 (26%)
zgc:110339NP_001017792.1 carb_red_sniffer_like_SDR_c 11..255 CDD:187586 69/275 (25%)
adh_short 11..217 CDD:278532 58/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.