DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:112146

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001017731.1 Gene:zgc:112146 / 550426 ZFINID:ZDB-GENE-050417-237 Length:256 Species:Danio rerio


Alignment Length:217 Identity:56/217 - (25%)
Similarity:94/217 - (43%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LITGASSGIGAATAIKFAK------YGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKE 67
            |:|||:.|:|.....:..:      :.||...:|.|.|.|:::|.:...|    ..||..|||..
Zfish    10 LVTGANRGLGLEMVKQLLEAHCSKVFAACRDPDGPNSEVLRELARKHLGV----VTLVKHDIADP 70

  Fly    68 ADTQRIWSETLQQYGK------LDVLVNNAGIIETGTIETTSLEQYDRVMNTN------------ 114
            :..:    |:.::.|.      |::|||||.|:...|:.|.::|......|||            
Zfish    71 SSIK----ESAEKVGSLLGEKGLNLLVNNAAILPQKTMLTATVEDMHNAFNTNVIGPLFVIREYL 131

  Fly   115 --LRAIYHLTMLATPELVKTKGNIVNVSSVNGIRS--------FPGVLAYNISKMGVDQFTRCVA 169
              |||....:  ..|.:...|..::|:|:.:...|        || ...|:|||.|::..|...|
Zfish   132 PYLRAAAKAS--GKPGMSSCKAAVINISTDSASMSMIPSMKDPFP-FFPYSISKAGLNMLTVYTA 193

  Fly   170 LELAAKGVRVNCVNPGVTVTNL 191
            .:|.|..:....::||...|::
Zfish   194 RDLKADEILCISIHPGWVRTDM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 56/217 (26%)
NADB_Rossmann 3..253 CDD:304358 56/217 (26%)
zgc:112146NP_001017731.1 carb_red_sniffer_like_SDR_c 9..256 CDD:187586 56/217 (26%)
adh_short 9..218 CDD:278532 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.