DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and pecr

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr / 550422 ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio


Alignment Length:263 Identity:78/263 - (29%)
Similarity:127/263 - (48%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECS-KVSQSQPALVVG---D 63
            |..||.::||..:|||.|...:..:.|..:.::.|.:|.||..|.|.: |:..|.||.|..   :
Zfish    12 FNHKVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERLKSAAEELTLKIPSSSPAKVTPIECN 76

  Fly    64 IAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPE 128
            |..|.:.:.:.:.||:.:|::|.||||.|...:......|.:.:..|::|||...:.....|...
Zfish    77 IRNEDEVKNLMASTLKLHGRIDFLVNNGGGQFSSPANMMSAKGWKAVIDTNLNGTFLCCREAYNA 141

  Fly   129 LVKTKGNIVNVSSVNGI----RSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT 189
            .:|..|.::    ||.|    :.|||:.....::..||..|:.:|:|.|..|||:|.|.||..::
Zfish   142 WMKDHGGVI----VNIIADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPGTIIS 202

  Fly   190 NLHARGGMDAETYKKFLEHSKTTHALGRP-------GDVKEVAAAIAFLASDEASFSTGVSLPVD 247
            .      ...|.||   |:..|...:..|       |..:|::.|:.||.|..|::.||.:|.||
Zfish   203 K------TAMENYK---EYGPTLFKMSVPFSPAKRLGVPEEISPAVCFLLSPAANYITGATLKVD 258

  Fly   248 GGR 250
            .|:
Zfish   259 AGQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 77/261 (30%)
NADB_Rossmann 3..253 CDD:304358 78/263 (30%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 70/247 (28%)
TER_DECR_SDR_a 28..263 CDD:187627 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.