DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and hsd17b8

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001016671.1 Gene:hsd17b8 / 549425 XenbaseID:XB-GENE-490296 Length:255 Species:Xenopus tropicalis


Alignment Length:248 Identity:71/248 - (28%)
Similarity:117/248 - (47%) Gaps:11/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECS-KVSQSQPALVVGDIAKEADT 70
            :.|:||..||||.|...:.:..||.:.:...::.:........| .:|..:.|....|::|....
 Frog    11 LALVTGGGSGIGRAICQRLSVEGASVVVVDLDISSANATLQTLSHNLSGQEHAAFATDVSKANHV 75

  Fly    71 QRIWSETLQQYG-KLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT-- 132
            ..:..:...:|. ...:.:::|||.:...:...|.|.:|.|:|.||:..:.:|......:|.:  
 Frog    76 NSLMQKIQGRYSVPPRIAISSAGITKDEFLLRLSEESFDSVLNVNLKGPFLITQAVARAIVASGE 140

  Fly   133 -KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGG 196
             .|:|:|:.|:.|.....|...|..||.||:..|:..|.|||..|:|.|.|.||...|      .
 Frog   141 HGGSIINIGSIVGKVGNLGQSNYAASKAGVEGLTKTAAKELAKFGIRCNTVLPGFIST------P 199

  Fly   197 MDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            |..:..:|.|:.......|||.|..:::|...||||||::.:.||.|:.|.||
 Frog   200 MTDKVPQKVLDKFAGMVPLGRLGYPEDIADVCAFLASDDSKYITGASIEVTGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 71/248 (29%)
NADB_Rossmann 3..253 CDD:304358 71/248 (29%)
hsd17b8NP_001016671.1 BKR_SDR_c 11..254 CDD:187594 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.