DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:113054

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001013468.1 Gene:zgc:113054 / 541322 ZFINID:ZDB-GENE-050320-9 Length:551 Species:Danio rerio


Alignment Length:249 Identity:85/249 - (34%)
Similarity:135/249 - (54%) Gaps:9/249 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |||..:|||..|||.|.|....:.||.:|:...:....:.||.|.:....|..| ||.||:|..|
Zfish   306 GKVAYVTGAGQGIGRAFAHALGEAGAKVAIIDMDRGKAEDVAHELTLKGISSMA-VVADISKPDD 369

  Fly    70 TQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT-K 133
            .|::..:.:.::|.|.:..|||||.:....|.||||::|:..|.|||..:.....|...::|. .
Zfish   370 VQKMIDDIVTKWGTLHIACNNAGINKNSASEETSLEEWDQTFNVNLRGTFMCCQAAGRVMLKQGY 434

  Fly   134 GNIVNVSSVNG-IRSFP-GVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGG 196
            |.|:|.:|:.. |...| ..|:||.||.||.:.|:.:..|...:||||||::||:..|.|     
Zfish   435 GKIINTASMASLIVPHPQKQLSYNTSKAGVVKLTQTLGTEWIDRGVRVNCISPGIVDTPL----- 494

  Fly   197 MDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGR 250
            :.:|:.:..::...:....||...|.::.||:.:||||.:.:.||.:|.::||:
Zfish   495 IHSESLEPLVQRWLSDIPAGRLAQVTDLQAAVVYLASDASDYMTGHNLVIEGGQ 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 84/247 (34%)
NADB_Rossmann 3..253 CDD:304358 85/249 (34%)
zgc:113054NP_001013468.1 YrrM 40..270 CDD:226607
AdoMet_MTases 59..270 CDD:302624
NADB_Rossmann 299..548 CDD:304358 84/247 (34%)
fabG 303..550 CDD:235546 85/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.