DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_081095.2 Gene:Dhrs1 / 52585 MGIID:1196314 Length:313 Species:Mus musculus


Alignment Length:254 Identity:73/254 - (28%)
Similarity:115/254 - (45%) Gaps:29/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |:|.::||||.|||...|::..|.||.:.:.||:::.|:..|.|...:. .:...||.|.::|::
Mouse     7 GQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRATAQEAQSLG-GRCVPVVCDSSQESE 70

  Fly    70 TQRIWSET-LQQYGKLDVLVNNAGIIETGTIETTS-------LEQYDRVMNTNLRAIYHLTMLAT 126
            .:.::.:. .:|.|:||||||||.......:.||:       ...:|.:.|..||..|..::...
Mouse    71 VKSLFEQVDREQKGRLDVLVNNAYAGVQAILNTTNKSFWEVPASIWDDINNVGLRGHYLCSVYGA 135

  Fly   127 PELVKT-KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTN 190
            ..:|.. ||.||.|||..|::....| .|.:.|...|:.....|.||...||....:.||:..| 
Mouse   136 RLMVPAGKGLIVIVSSPGGLQHMFNV-PYGVGKAACDRLAADCAHELRRHGVSYVSLWPGLVQT- 198

  Fly   191 LHARGGMDAETYKKFLEHSKTTHALGRPGD--VKEVAAAIAFLASDEASFSTGVSLPVD 247
                     |..|:|:....|      |.|  .|::....:...|.|.|....|:|..|
Mouse   199 ---------EMVKEFMAKEDT------PEDPLFKKMKPDFSSAESPEMSGKCVVALATD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 73/254 (29%)
NADB_Rossmann 3..253 CDD:304358 73/254 (29%)
Dhrs1NP_081095.2 DHRS1-like_SDR_c 5..271 CDD:187664 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830576
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.