DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and HSD17B14

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:256 Identity:89/256 - (34%)
Similarity:130/256 - (50%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLAL------NGRNVENLKKVAAECSKVSQSQP--AL 59
            :|||||::||...||||.....|...||.:.:      .||.:|             |..|  ..
Human     7 YAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALE-------------QELPGAVF 58

  Fly    60 VVGDIAKEADTQRIWSETLQQYGKLDVLVNNAG-IIETGTIETTSLEQYDRVMNTNLRAIYHLTM 123
            ::.|:.:|.|.:.:.|||::::|:||.:||||| .......|.||.:.:.:::..||...|.||.
Human    59 ILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTK 123

  Fly   124 LATPELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            ||.|.|.|::||::|:||:.|.......:.|..:|..|...|:.:||:.:..||||||::||...
Human   124 LALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIW 188

  Fly   189 TNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            |.|...........:..:........|||.|...||.||..|||| ||:|.||:.|.|.||
Human   189 TPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLAS-EANFCTGIELLVTGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 89/256 (35%)
NADB_Rossmann 3..253 CDD:304358 89/256 (35%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 89/256 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5306
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4508
Isobase 1 0.950 - 0.928771 Normalized mean entropy S6398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.