DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and RDH8

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:265 Identity:74/265 - (27%)
Similarity:114/265 - (43%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFA-----KYGACLALN--GRNVENLKKVAAECSKVSQSQPA 58
            |..|.:.|||:|.|||||...|::.|     :|.....:.  |:. |.|:..|.|          
Human     1 MAAAPRTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLGKK-ETLEAAAGE---------- 54

  Fly    59 LVVGDIAKEADTQRIWSETLQQ-----YGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAI 118
             .:|.....|.......|::.|     .|::||||||||:...|.:|..||.....|.:||....
Human    55 -ALGQTLTVAQLDVCSDESVAQCLSCIQGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGA 118

  Fly   119 YHLTMLATPELVKTK-GNIVNVSSVNGIRSFPGVL---AYNISKMGVDQFTRCVALELAAKGVRV 179
            ..|.....|.:.:.: |:||.:|||.|::   ||:   .|..||..::.|...:|::|....:.:
Human   119 VRLVKAVLPGMKRRRQGHIVVISSVMGLQ---GVIFNDVYAASKFALEGFFESLAIQLLQFNIFI 180

  Fly   180 NCVNPGVTVTNLHAR----------GGMDAETYKKFLE-----HSKTTHALGR-PGDVKEVAAAI 228
            :.|.||..||....:          .|.|.||...|.:     ..|...::|: |.||  |.|.:
Human   181 SLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDV--VQAIV 243

  Fly   229 AFLAS 233
            ..::|
Human   244 NVISS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 74/265 (28%)
NADB_Rossmann 3..253 CDD:304358 73/263 (28%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.