DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and zgc:101858

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 / 449555 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio


Alignment Length:251 Identity:166/251 - (66%)
Similarity:196/251 - (78%) Gaps:0/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADT 70
            ||.|||||||||||.||:.|||.||.||||||:||||.|||.||.....::|.||.||:..|...
Zfish    15 KVTLITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECEACGAAKPLLVAGDLTDEETV 79

  Fly    71 QRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTKGN 135
            :|...|.:..:|:||||||:|||:..|:||||.:.|||:||:.|:|:|||||.|..|.|:||||:
Zfish    80 RRTVEEVIAHFGRLDVLVNSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLTHLCVPHLIKTKGS 144

  Fly   136 IVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGMDAE 200
            |||||||||.|||||||||.:||..:||||||||||||:|.||||.|.|||.:|.:|.|.|:|.|
Zfish   145 IVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVIITEVHKRAGLDEE 209

  Fly   201 TYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256
            .|.:|:|..|.||||||||:|.|||.||||||||.|:|.|||:|||||||||||||
Zfish   210 QYAQFIEKCKVTHALGRPGEVDEVAHAIAFLASDAATFITGVNLPVDGGRHAMCPR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 158/243 (65%)
NADB_Rossmann 3..253 CDD:304358 161/246 (65%)
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 159/244 (65%)
SDR_c11 12..262 CDD:187622 161/246 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 310 1.000 Domainoid score I1299
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 332 1.000 Inparanoid score I2411
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm25823
orthoMCL 1 0.900 - - OOG6_101836
Panther 1 1.100 - - LDO PTHR43975
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.