DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and MGC79752

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 / 448527 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis


Alignment Length:256 Identity:155/256 - (60%)
Similarity:195/256 - (76%) Gaps:0/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            :|...||.|:|||||||||.||:.||:.||.|||||||.|.|::.|..|.:.|..:|.||.||:.
 Frog     9 INLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFSGMKPLLVPGDLT 73

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            .|...::|..:|:..:|:||||||:.||:..||:|.|||:.:|||||.|:|::::||.||.|.|:
 Frog    74 DEESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHLI 138

  Fly   131 KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
            :|||||||||||||.|||||||||.:||..|||.|||.|||||.|.||||.|.|||.:|::|.|.
 Frog   139 QTKGNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRA 203

  Fly   196 GMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256
            |::.|.|.:|::.::.||||||||.|.|||..|||||||.|||.|||::||||||||||||
 Frog   204 GLNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGGRHAMCPR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 147/248 (59%)
NADB_Rossmann 3..253 CDD:304358 149/249 (60%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 149/249 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I1409
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 324 1.000 Inparanoid score I2455
OMA 1 1.010 - - QHG45843
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm48147
Panther 1 1.100 - - LDO PTHR43975
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.