DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and hsd17b14

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001003521.1 Gene:hsd17b14 / 445127 ZFINID:ZDB-GENE-040801-24 Length:271 Species:Danio rerio


Alignment Length:258 Identity:74/258 - (28%)
Similarity:129/258 - (50%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLAL--------NGRNVENL--KKVAAECSKVSQSQP 57
            :..|||::||.:.|||......|.:.|:.:..        .|:::|::  |:....|..||    
Zfish     7 YQNKVVIVTGGTRGIGRGIVKTFVQNGSKVVFCAPQTEMSAGQSLESVLNKEGPGSCKFVS---- 67

  Fly    58 ALVVGDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIET-GTIETTSLEQYDRVMNTNLRAIYHL 121
                .|:.:|.|.:::.:.|::.:|::|.||||.|.... .|.:.||.|::..::|.||.:.:..
Zfish    68 ----CDMREEEDIKQLINVTVESFGQIDCLVNNVGWHPPHKTTDETSGEEFKDLLNLNLISFFLA 128

  Fly   122 TMLATPELVKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGV 186
            :..|.|.|.||:|||:|:||:...........|..:|..:...|:.:|::.:...|||||::|..
Zfish   129 SKYALPYLRKTQGNIINLSSLVASIGQKDAAPYVATKGAITAMTKAMAVDESRYQVRVNCISPSN 193

  Fly   187 TVTNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .:|.|......:.|.....::..:....:||.|...|...|..|||:| |:|.||:.|.:.||
Zfish   194 IMTPLWEELAANTEDTAATIKGGEDAQLIGRMGTEAESGLAALFLAAD-ATFCTGIDLFLSGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 74/258 (29%)
NADB_Rossmann 3..253 CDD:304358 74/258 (29%)
hsd17b14NP_001003521.1 RDH_SDR_c 1..263 CDD:187638 74/258 (29%)
adh_short 26..205 CDD:278532 49/186 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487970at33208
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.