DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and decr1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001002444.2 Gene:decr1 / 436717 ZFINID:ZDB-GENE-040718-142 Length:333 Species:Danio rerio


Alignment Length:256 Identity:65/256 - (25%)
Similarity:116/256 - (45%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKE 67
            |..||..|||..:|:|.|.....:..||...:..|:::.|:|.|.|.|:.:.::...:..::...
Zfish    55 FKNKVAFITGGGTGLGKAMTTTLSSLGAECVIASRSLDVLQKTADEISQQTGNKVHAIRCNVRDP 119

  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            |..:....:.::..|..||::|||........|..|...:..:....|....::|:.....|:|.
Zfish   120 ASVEAAVDQLVKDVGLPDVVINNAAGNFISPSEKLSPNAWKTITEIVLNGNAYVTLDIGKRLIKA 184

  Fly   133 -KG-NIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVT-----N 190
             || ..::::::........|:....:|.||::....:|.|.:..|:|.|.:.||...|     .
Zfish   185 EKGAAFLSITTIYAESGSGFVVPSAAAKSGVEKLCTSLAAEWSRYGMRFNVIQPGPIKTKGAFSR 249

  Fly   191 LHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRH 251
            |...|..:    ||.|:..    |:||.|...|:|...|:|.||.||:.:|..:.:|||.:
Zfish   250 LDPAGVFE----KKILDRV----AVGRLGTPGEIANLAAYLCSDYASWVSGAIIRMDGGEY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 64/253 (25%)
NADB_Rossmann 3..253 CDD:304358 65/256 (25%)
decr1NP_001002444.2 TER_DECR_SDR_a 55..301 CDD:187627 64/253 (25%)
PRK07677 57..302 CDD:181077 64/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.