DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and decr2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_005162937.1 Gene:decr2 / 406623 ZFINID:ZDB-GENE-040426-2612 Length:301 Species:Danio rerio


Alignment Length:247 Identity:76/247 - (30%)
Similarity:119/247 - (48%) Gaps:8/247 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADT 70
            :|..|||..||||...|....::|....:..||:|.:.:.|.:.:..:..:...:..|:.:....
Zfish    36 QVAFITGGGSGIGFRIAEVLMRHGCDTVIASRNLEKISQAAKKLTSTTGRRCLPIAMDVRQPETI 100

  Fly    71 QRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK-G 134
            .....|||:.:|::|:|:|||.........:.|...:..||..:....::.:.:...:..|.. |
Zfish   101 LAAVDETLKTFGRVDILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGG 165

  Fly   135 NIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPG-VTVTNLHAR-GGM 197
            :|||:|:..|.|.....:....:|...|..||.:|:|....|||||.|.|| ::.|..:.| ||.
Zfish   166 SIVNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISGTEGYRRLGGS 230

  Fly   198 DAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .|||...|  ||   ..|.|.|:..|:|.|:.||||..:|:.||..|..|||
Zfish   231 HAETAGAF--HS---IPLQRAGNKTEMAHAVLFLASRASSYVTGSVLVADGG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 76/247 (31%)
NADB_Rossmann 3..253 CDD:304358 76/247 (31%)
decr2XP_005162937.1 PRK07576 33..283 CDD:236056 76/247 (31%)
TER_DECR_SDR_a 33..280 CDD:187627 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.