DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and rdh8b

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_957082.2 Gene:rdh8b / 393761 ZFINID:ZDB-GENE-040426-1759 Length:317 Species:Danio rerio


Alignment Length:255 Identity:62/255 - (24%)
Similarity:107/255 - (41%) Gaps:35/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAG-KVVLITGASSGIGAATAIKFA-----KYGACLALNGRNVENLKKVAAECSKVSQSQPAL 59
            |..|| |||||||.|||||...|:..|     :|.....:  |:::...|:.............:
Zfish     1 MASAGQKVVLITGCSSGIGLGIAVMLARDKQQRYYVIATM--RDLKRQDKLVCAAGDTYGKTLTV 63

  Fly    60 VVGDIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTML 124
            ...|:......::.......::  :|:|:||||:...|.:|..||:...:|..||......:...
Zfish    64 CTLDVCSNESVRQCVDSVKDRH--IDILINNAGVGLVGPVEGLSLDDMMKVFETNFFGAVRMIKE 126

  Fly   125 ATPELVKTK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTV 188
            ..|::.|.: |:|:.:|||.|::.......|..||..::.|...:|::|....|.::.:.||...
Zfish   127 VMPDMKKRRSGHIIVISSVMGLQGVAFNDVYAASKFAIEGFCESLAVQLLKFNVTMSMIEPGPVH 191

  Fly   189 TNLHAR----------GGMDAETYKKFLEHSKTTH---------ALGR-PGDVKEVAAAI 228
            |....:          ...|.||    :.|.:|.:         .||: |.|:.:|...:
Zfish   192 TEFEMKMYDDVSKKEYPNTDPET----MHHFRTCYLPTSVNIFQGLGQTPEDIAKVTKKV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 62/255 (24%)
NADB_Rossmann 3..253 CDD:304358 61/253 (24%)
rdh8bNP_957082.2 type1_17beta-HSD-like_SDR_c 7..264 CDD:187666 59/249 (24%)
adh_short 7..202 CDD:278532 49/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.