DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and dhrs4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 / 393539 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio


Alignment Length:256 Identity:82/256 - (32%)
Similarity:145/256 - (56%) Gaps:13/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---D 63
            |.:|||.::|.::.|||.|.|....:.||.:.::.|...|:.|..:    :.:|:...|:|   :
Zfish    27 NLSGKVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDKAVS----LLRSKNIKVIGTTCN 87

  Fly    64 IAKEADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATP 127
            :.|..|.:::.:.|::|.|.:|:||:||.:.. .|.|..::.|.:|:::..|::|.:.||.:..|
Zfish    88 VGKAEDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEVWDKILGVNVKASFLLTKMVVP 152

  Fly   128 ELVKT-KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            .:.|. .|::|.||||.|.:..|.:..|::||..:...||.:|.|||...:|||||.||:..|..
Zfish   153 HIEKRGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRF 217

  Fly   192 HARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHA 252
            .:....:....::||:.:    ::.|.|..:|:...||||.|||||:.||.::.|.||.::
Zfish   218 SSALWENEGVLEEFLKQT----SIKRLGQPEEIGGVIAFLCSDEASYITGETITVTGGMNS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 81/252 (32%)
NADB_Rossmann 3..253 CDD:304358 81/255 (32%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 82/256 (32%)
fabG 28..272 CDD:235975 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.