DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and cbr1

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:241 Identity:67/241 - (27%)
Similarity:94/241 - (39%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAK-YGACLALNGRN-------VENLKKVAAECSKVSQSQPALVVG 62
            ||.|:|||:.|||.|......| |...:.|:.|:       |::|||...        .|.....
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGRGTAAVDSLKKEGL--------HPLFHQL 61

  Fly    63 DIAKEADTQRIWSETLQQ-YGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126
            || .:.::.|...:..|: ||.||||:|||||.......|....|.|..:.||..|...:..:..
Zfish    62 DI-NDPNSVRTARDFFQEKYGGLDVLINNAGIAFKMADTTPFGTQADVTLKTNFFATRDMCNVFL 125

  Fly   127 PELVKTKGNIVNVSS---------------------------VNGI---------------RSFP 149
            | ::|..|.:|||||                           :||:               |.:|
Zfish   126 P-IIKPGGRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSERGWP 189

  Fly   150 GVLAYNISKMGVDQFTRCVALELAAK----GVRVNCVNPGVTVTNL 191
            .. ||.|||.|:...||..|..|..:    |:..|...||...|::
Zfish   190 ST-AYGISKTGLTTLTRIQARNLTKERPGDGILCNACCPGWVRTDM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 67/241 (28%)
NADB_Rossmann 3..253 CDD:304358 67/241 (28%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 67/241 (28%)
adh_short 5..237 CDD:278532 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.