DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CG13284

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:214 Identity:57/214 - (26%)
Similarity:105/214 - (49%) Gaps:17/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            |:..::|||:.|||...|.:.|:.|..|.|..|..|.|..|..|.....:.:...:..|.||   
  Fly    70 GQWAVVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEIESQYKVKTKWIAADFAK--- 131

  Fly    70 TQRIWSETLQQYGKLDV--LVNNAGII--ETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            .:.::.:..::...:||  ||||.|::  ...:::..|.:....::..|:.::..||....|:::
  Fly   132 GREVYDQIEKELAGIDVGILVNNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKILPQMI 196

  Fly   131 -KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA- 193
             :.||.|||:.|.:.::..|.:..|..||..|..|::.:.||:|...:.|..|.|...||.::| 
  Fly   197 GRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLVMPNFVVTKMNAY 261

  Fly   194 -----RGGM---DAETYKK 204
                 :||:   :|.|:.:
  Fly   262 TDRVMQGGLFFPNAYTFAR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 57/214 (27%)
NADB_Rossmann 3..253 CDD:304358 57/214 (27%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 57/214 (27%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 57/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.