DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and cbr1l

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_919360.1 Gene:cbr1l / 337696 ZFINID:ZDB-GENE-030131-9642 Length:277 Species:Danio rerio


Alignment Length:176 Identity:53/176 - (30%)
Similarity:73/176 - (41%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYG--ACLALNGRNVENLKKVAAECSKVSQSQPALVVG----DI 64
            ||.::|||:.|||.|......|.|  ..:.|..||    :|:..|.....||:....|.    ||
Zfish     4 KVAVVTGANKGIGLAIVKGLCKAGFTGDILLTARN----EKLGQEAIAGLQSEGFKNVVFHQLDI 64

  Fly    65 AKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129
            ..:....::.....::||.||||:|||||...........||.:..|.||............| :
Zfish    65 CDQGSCMKLKKFLEEKYGGLDVLINNAGIAFKNAATEPFGEQAEVTMRTNFWGTLWACHALLP-I 128

  Fly   130 VKTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAK 175
            ::....:|||||.             :||..:||   |.| ||.||
Zfish   129 LRANARVVNVSSF-------------VSKKSLDQ---CSA-ELQAK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 53/176 (30%)
NADB_Rossmann 3..253 CDD:304358 53/176 (30%)
cbr1lNP_919360.1 carb_red_PTCR-like_SDR_c 4..277 CDD:187585 53/176 (30%)
adh_short 4..242 CDD:278532 53/176 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.