DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CG9360

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:200 Identity:55/200 - (27%)
Similarity:90/200 - (45%) Gaps:17/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---DIAKE 67
            :|.::||||||||||........|..:....|..:.|:::.|   .:...|.:...|   |:::|
  Fly     7 RVAVVTGASSGIGAACCKDLVSKGLVVVGLARREDRLQELKA---SLPADQASRFHGRKCDVSQE 68

  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYD--RVMNTNLRAIYHLTMLATPELV 130
            .:....::......|..|||||||||:..|...|......|  .:::||:..:...|..|...|.
  Fly    69 QEVIDAFAWIDATLGGADVLVNNAGIVRLGVGITHEGNGADLRAILDTNVLGVSWCTREAFKSLK 133

  Fly   131 K---TKGNIVNVSSVNGIR--SFPGVL--AYNISKMGVDQFTRCVALEL--AAKGVRVNCVNPGV 186
            :   ..|:|:.|:||.|.|  :.||:.  .|:.||..|...|..:..|.  .....::..::||.
  Fly   134 RRNVNDGHILIVNSVAGHRVINNPGITMGMYSPSKYAVTALTEVLRQEFHNNKTQTKITSISPGA 198

  Fly   187 TVTNL 191
            ..|.:
  Fly   199 VDTEI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 55/199 (28%)
NADB_Rossmann 3..253 CDD:304358 55/199 (28%)
CG9360NP_572746.1 YdfG 1..250 CDD:226674 55/199 (28%)
NADB_Rossmann 1..246 CDD:304358 55/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.