DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and antdh

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:106/235 - (45%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADT 70
            :|.::||||||||:|.|......|..:....|.|:.:|::..|.....:.:...:..|:..|:..
  Fly     7 RVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKLFALYCDVGNESSV 71

  Fly    71 QRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTK-- 133
            ...:...:|:.|.:||||||||.::.|.:...:.....:|:.||:..|...|..|...:.:.|  
  Fly    72 NEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFD 136

  Fly   134 GNIVNVSSVNGIRSF-------PGVLAYNISKMGVDQFTRCVALELAAKG--VRVNCVNPGVTVT 189
            |::|.::|:.|.::.       |.|..|..||..|.........|....|  :::..|:|||..|
  Fly   137 GHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVSPGVVDT 201

  Fly   190 NLHARGGMDA--ETYKKFLEHSK-----TTHALGRPGDVK 222
            .:..    |:  |..|..:.||:     ..:|:..|..|:
  Fly   202 EIVP----DSIREAIKDRMLHSEDIAQGVLYAIATPPHVQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 61/235 (26%)
NADB_Rossmann 3..253 CDD:304358 61/235 (26%)
antdhNP_572695.2 YdfG 1..250 CDD:226674 61/235 (26%)
NADB_Rossmann 1..245 CDD:304358 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.