DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and DHRS4L2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_932349.2 Gene:DHRS4L2 / 317749 HGNCID:19731 Length:232 Species:Homo sapiens


Alignment Length:204 Identity:60/204 - (29%)
Similarity:108/204 - (52%) Gaps:12/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---DIAKE 67
            ||.|:|.::.|||.|.|.:.|:..|.:.::.|..:|:.:..|    ..|.:...|.|   .:.|.
Human    33 KVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVA----TLQGEGLSVTGTVCHVGKA 93

  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            .|.:|:.:..::.:|.:|:||:||.:.. .|::...:.|.:|:.::.|::|...:|....||:.|
Human    94 EDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK 158

  Fly   132 T-KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
            . .|::|.|||:......||...||:||..:......:|:|||.:.:||||::  :.::.| |..
Human   159 RGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLH--LDLSRL-ASA 220

  Fly   196 GMDAETYKK 204
            |....|.||
Human   221 GCSGWTRKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 60/204 (29%)
NADB_Rossmann 3..253 CDD:304358 60/204 (29%)
DHRS4L2NP_932349.2 NADB_Rossmann 24..>210 CDD:304358 53/180 (29%)
adh_short 33..210 CDD:278532 53/180 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.