Sequence 1: | NP_730974.1 | Gene: | CG31548 / 318794 | FlyBaseID: | FBgn0051548 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_932349.2 | Gene: | DHRS4L2 / 317749 | HGNCID: | 19731 | Length: | 232 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 60/204 - (29%) |
---|---|---|---|
Similarity: | 108/204 - (52%) | Gaps: | 12/204 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG---DIAKE 67
Fly 68 ADTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
Fly 132 T-KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
Fly 196 GMDAETYKK 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31548 | NP_730974.1 | fabG | 1..250 | CDD:235975 | 60/204 (29%) |
NADB_Rossmann | 3..253 | CDD:304358 | 60/204 (29%) | ||
DHRS4L2 | NP_932349.2 | NADB_Rossmann | 24..>210 | CDD:304358 | 53/180 (29%) |
adh_short | 33..210 | CDD:278532 | 53/180 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140604 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000019 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |