DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and sni

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:88/229 - (38%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLITGASSGIG---AATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEAD 69
            :||||.:.|:|   ....:...:....|....||.|..|::.                |:||...
  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELE----------------DLAKNHS 52

  Fly    70 TQRIWSETLQQ---YGK-------------LDVLVNNAGII-ETGTIETTSLEQYDRVMNTNLRA 117
            ...|....|:.   |.|             |:||.|||||. ::..|.....::....:.||...
  Fly    53 NIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVV 117

  Fly   118 IYHLTMLATPELVK-TKGN-----------IVNVSSVNGI---RSFPGVLAYNISKMGVDQFTRC 167
            ...|.....|.|.| .|.|           |:|:||:.|.   .:..|:.||..||..::..|:.
  Fly   118 PIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKS 182

  Fly   168 VALELAAKGVRVNCV--NPGVTVTNLHARGGMDA 199
            ::::|..:  |:.||  :||...|::   ||..|
  Fly   183 LSVDLYPQ--RIMCVSLHPGWVKTDM---GGSSA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 56/229 (24%)
NADB_Rossmann 3..253 CDD:304358 56/229 (24%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 56/229 (24%)
adh_short 4..209 CDD:278532 54/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.