DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CG3699

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:256 Identity:132/256 - (51%)
Similarity:175/256 - (68%) Gaps:5/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            |:.:.|||::||||||||||.|...|:.||.|||.||||.||:   |....:..:|..:||.|:.
  Fly     1 MSLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLE---ATKKSLKGTQAEIVVADVT 62

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            |:||.  |..:||.::|::|||||||||:..|.:....:|::|.|:|||||.:..||....|.|:
  Fly    63 KDADA--IVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLL 125

  Fly   131 KTKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARG 195
            ||||.:|||||..|||.|.|.|:|.:||..:||||:.||||:|.:|||||.||||..|||:|...
  Fly   126 KTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNI 190

  Fly   196 GMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256
            |:..|.|...|:.:..:|.:||.|||.|||.|:|||||.:|||:||...|:|||:|.:.||
  Fly   191 GIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 128/248 (52%)
NADB_Rossmann 3..253 CDD:304358 129/249 (52%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 127/247 (51%)
NADB_Rossmann 3..248 CDD:304358 129/249 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435104
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111187at6656
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm42920
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43975
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
109.900

Return to query results.
Submit another query.