DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and CG13377

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:206 Identity:43/206 - (20%)
Similarity:89/206 - (43%) Gaps:20/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECS--KVSQSQPALVVG------ 62
            :|||||.|.:.:|.......|..|..:....:..::.......|.  |:.:.....:.|      
  Fly    46 RVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSEEPIAGTIIPMR 110

  Fly    63 ------DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHL 121
                  |:.:|| |..|.:........:..::|.:|.:..|.:|:.:::|::.::.||:.....:
  Fly   111 LDVTREDVLREA-TVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHMLRTNILGTLRV 174

  Fly   122 TMLATPELVKTKGNIVNVSSVNG----IRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCV 182
            .......|..|:|.::.:..|:|    .....|::|:|.|::.||:....:..||...||.|..:
  Fly   175 AKAFVCFLRPTRGRLLYLGGVSGGGNARNEGDGLVAFNASRVAVDKCAEELRKELHPYGVSVVAL 239

  Fly   183 NP-GVTVTNLH 192
            :. |:|..:|:
  Fly   240 DTCGMTAESLY 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 43/206 (21%)
NADB_Rossmann 3..253 CDD:304358 43/206 (21%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 41/200 (21%)
NADB_Rossmann 46..>237 CDD:304358 39/191 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.