powered by:
Protein Alignment CG31548 and RGD1564324
DIOPT Version :9
Sequence 1: | NP_730974.1 |
Gene: | CG31548 / 318794 |
FlyBaseID: | FBgn0051548 |
Length: | 256 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099505.1 |
Gene: | RGD1564324 / 290217 |
RGDID: | 1564324 |
Length: | 107 |
Species: | Rattus norvegicus |
Alignment Length: | 43 |
Identity: | 12/43 - (27%) |
Similarity: | 16/43 - (37%) |
Gaps: | 9/43 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 AAECSKVSQSQPALVVGDIAKEADTQRIWSETLQQYGKLDVLV 88
|..|| .|..:.|..|.|...::.|...|.:|.||
Rat 50 AGTCS---------TVWHVGKAEDWQGPGAKALGYLGGVDFLV 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0725 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.