DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and RGD1564324

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099505.1 Gene:RGD1564324 / 290217 RGDID:1564324 Length:107 Species:Rattus norvegicus


Alignment Length:43 Identity:12/43 - (27%)
Similarity:16/43 - (37%) Gaps:9/43 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AAECSKVSQSQPALVVGDIAKEADTQRIWSETLQQYGKLDVLV 88
            |..||         .|..:.|..|.|...::.|...|.:|.||
  Rat    50 AGTCS---------TVWHVGKAEDWQGPGAKALGYLGGVDFLV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 12/43 (28%)
NADB_Rossmann 3..253 CDD:304358 12/43 (28%)
RGD1564324NP_001099505.1 NADB_Rossmann <55..>105 CDD:304358 9/29 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.