DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:210 Identity:72/210 - (34%)
Similarity:102/210 - (48%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQS-----QPALVVGDIAK 66
            ||::|||:||:|...|..|...||.:.|.||||:.|::...|.:..|.|     ||.:|..|:|.
  Rat    54 VVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLAD 118

  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            ........:|.||.:|.:|:|:|||||...|.|..|.::...:||..|......||....|.:|:
  Rat   119 PGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVE 183

  Fly   132 TK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHAR- 194
            .| |:||.:||:.|..|.|...||..||.....|..|:..|:....:.|..::||...|||... 
  Rat   184 RKRGHIVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNA 248

  Fly   195 --------GGMDAET 201
                    |.:|..|
  Rat   249 VTADGSRYGALDKNT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 72/210 (34%)
NADB_Rossmann 3..253 CDD:304358 72/210 (34%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 72/210 (34%)
PRK06181 52..321 CDD:235726 72/210 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.