DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001033027.2 Gene:Dhrs4 / 28200 MGIID:90169 Length:279 Species:Mus musculus


Alignment Length:248 Identity:74/248 - (29%)
Similarity:132/248 - (53%) Gaps:7/248 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEA 68
            :.||.|:|.::.|||.|.|.:.|:.||.:.::.|..:|:.:..|.......|...:|. .:.|..
Mouse    32 SNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVC-HVGKAE 95

  Fly    69 DTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            |.:::.:..|:::..:|:||:||.:.. .|.:...:.|.:|:|::.|:.|...:.....||:.|.
Mouse    96 DREKLITTALKRHQGIDILVSNAAVNPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKR 160

  Fly   133 -KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGG 196
             .|::|.|.||.|...||.:..||:||..:...|:..|.|||.|.:||||:.||:..|.. :...
Mouse   161 GGGSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRF-SSVL 224

  Fly   197 MDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .:.:..:.|::.:.....||:|.|   .|..::||.|::||:..|.::.|.||
Mouse   225 WEEKAREDFIKEAMQIRRLGKPED---CAGIVSFLCSEDASYINGETVVVGGG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 74/248 (30%)
NADB_Rossmann 3..253 CDD:304358 74/248 (30%)
Dhrs4NP_001033027.2 CR_SDR_c 24..279 CDD:187641 74/248 (30%)
fabG 31..274 CDD:235975 72/246 (29%)
Microbody targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.