DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and rdh8a

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_957001.1 Gene:rdh8a / 280648 ZFINID:ZDB-GENE-021115-3 Length:318 Species:Danio rerio


Alignment Length:219 Identity:58/219 - (26%)
Similarity:104/219 - (47%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFA-----KYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIA 65
            |||||||.|||||...|:..|     :|.....:  |:::...::.....:|......|:..||.
Zfish     8 KVVLITGCSSGIGLRIAVLLARDEQKRYHVIATM--RDLKKKDRLVEAAGEVYGQTLTLLPLDIC 70

  Fly    66 KEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELV 130
            .:...::..:....::  :|||:||||:...|.:|:.|:::..||..||......:.....|::.
Zfish    71 SDESVRQCVNSVKDRH--IDVLINNAGVGLLGPVESISMDEMKRVFETNFFGTVRMIKEVMPDMK 133

  Fly   131 KTK-GNIVNVSSVNGIRSFPGVL---AYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191
            |.: |:|:.:|||.|::   ||:   .|..||..::.|...:|::|....|:::.:.||...|..
Zfish   134 KRQAGHIIIMSSVMGLQ---GVVFNDVYTASKFAIEGFCESMAVQLLKFNVKLSLIEPGPVHTEF 195

  Fly   192 HAR----------GGMDAETYKKF 205
            ..:          .|.|.:|.:.|
Zfish   196 ETKMMEEVAKMEYPGADPDTVRYF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 58/219 (26%)
NADB_Rossmann 3..253 CDD:304358 58/219 (26%)
rdh8aNP_957001.1 type1_17beta-HSD-like_SDR_c 8..265 CDD:187666 58/219 (26%)
adh_short 8..207 CDD:278532 54/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.