DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Dhrs4

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_695227.2 Gene:Dhrs4 / 266686 RGDID:708482 Length:279 Species:Rattus norvegicus


Alignment Length:255 Identity:78/255 - (30%)
Similarity:129/255 - (50%) Gaps:21/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEA 68
            |.||.|:|.::.|||.|.|.:.|:.||.:.::.|..:|:.:..|.......|... ||..:.|..
  Rat    32 ANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQGEGLSVTG-VVCHVGKAE 95

  Fly    69 DTQRIWSETLQQYGKLDVLVNNAGIIE-TGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKT 132
            |.:::.:..|:.:..:|:||:||.:.. .|.:...:.|.:::|::.|:.|...:.....|.:.|.
  Rat    96 DREKLVNMALKLHQGIDILVSNAAVNPFFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAMEKR 160

  Fly   133 -KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL----- 191
             .|::|.||||.|...||.:..||:||..:...|:..|.|||.|.:||||:.||:..|:.     
  Rat   161 GGGSVVIVSSVAGFVLFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHFSSVLW 225

  Fly   192 --HARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
              .||..|..||.:        ...||:|.|   ....::||.|::||:..|.::.|.||
  Rat   226 KEKAREEMIKETMQ--------IRRLGKPED---CVGIVSFLCSEDASYINGETVVVGGG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 78/255 (31%)
NADB_Rossmann 3..253 CDD:304358 78/255 (31%)
Dhrs4NP_695227.2 CR_SDR_c 24..279 CDD:187641 78/255 (31%)
Microbody targeting signal 277..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.