DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and Decr2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_036063.1 Gene:Decr2 / 26378 MGIID:1347059 Length:292 Species:Mus musculus


Alignment Length:256 Identity:68/256 - (26%)
Similarity:117/256 - (45%) Gaps:26/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENL-----KKVAA---ECSKVSQSQPALVVG 62
            ||..|||..||||...|..|.::|....:.||:::.:     |.|||   .|..:|.        
Mouse    29 KVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSM-------- 85

  Fly    63 DIAKEADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATP 127
            |:....:......:.||::||:::|:|.|...........|...:..|::.:....::::.:...
Mouse    86 DVRVPPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYK 150

  Fly   128 ELVKTKGN-IVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGV---TV 188
            :..:..|. |||:::...:|.....|....:|..||..||.:|:|...:.:|||.:.||.   |.
Mouse   151 KFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTE 215

  Fly   189 TNLHARGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .....||...:...|.|      ::.:.|.|...|:|.::.:|||..||:.:|:.|.||||
Mouse   216 GLRRLRGSNASSKLKHF------SNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 68/256 (27%)
NADB_Rossmann 3..253 CDD:304358 68/256 (27%)
Decr2NP_036063.1 TER_DECR_SDR_a 26..273 CDD:187627 68/256 (27%)
PRK07576 26..271 CDD:236056 68/256 (27%)
Substrate binding. /evidence=ECO:0000250 126..128 1/1 (100%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.