DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and oar2

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 / 2543512 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:73/247 - (29%)
Similarity:123/247 - (49%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEADTQR 72
            |||||.|||:|...|..:::.|....:.|||..:||:.....|.....|..|.:.|:..:....:
pombe     4 VLITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADVQSDMKNLK 68

  Fly    73 IWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVKTKGN-- 135
            ...|:::    :|.:|:.||::::.....||.::.|.::.|||.:...|:.:|..|..:.|.:  
pombe    69 SIFESVE----IDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWFRNKNSER 129

  Fly   136 ---IVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGGM 197
               |:|:||.....:.||...|..||.|::.||:.:|.|:|:||:|||.::||...|.: ....:
pombe   130 DRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPM-LSSQI 193

  Fly   198 DAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249
            .|...||.        .:||.....|:..|..||..:.  ::||..||:.||
pombe   194 RAIAEKKV--------PIGRLASTDEIVDACTFLLDNR--YTTGTILPITGG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 73/247 (30%)
NADB_Rossmann 3..253 CDD:304358 73/247 (30%)
oar2NP_594074.1 FabG 1..236 CDD:223959 73/247 (30%)
SDR_c 4..233 CDD:212491 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1456
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.