DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31548 and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:258 Identity:83/258 - (32%)
Similarity:128/258 - (49%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLA-LNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEA 68
            ||..||||.|.|||.:.|..||..|:.:. |.|||.:.| :.|||.......|.......|...:
pombe     9 GKTTLITGGSGGIGFSIAKAFAAAGSNVGLLYGRNKKAL-EYAAELRDKHGVQAKAYSCPIENRS 72

  Fly    69 DTQRIWSETLQQY-GKLDVLVNNAGI-IETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131
            ......::.:::. |:|||::.|||| |...::|..:.:.:.:|:..||...|:....|.....|
pombe    73 AVIETTNQAVEELGGRLDVMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKK 137

  Fly   132 T-KGNIVNVSSVNG-IRSFPGVLA-YNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHA 193
            . ||:::..:|::| |.::|...| |:.:|..|....|.:|:|. |...|||.|:||...|:|..
pombe   138 QGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEW-APFARVNSVSPGYIDTDLTL 201

  Fly   194 RGGMDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256
            ..  |....||:.|::.... :|.|   .|:..|..:||||.:|:.||..:.||||   .|.|
pombe   202 YA--DENLRKKWKEYTPQAR-IGLP---DELPGAYLYLASDASSYCTGSDIIVDGG---YCSR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31548NP_730974.1 fabG 1..250 CDD:235975 80/250 (32%)
NADB_Rossmann 3..253 CDD:304358 81/253 (32%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 81/253 (32%)
MDH-like_SDR_c 2..254 CDD:187610 81/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.